In This Store
Category:Intermediates > Pharmaceutical Intermediates
Product Name:ELA-32 (human)
CAS No.:1680205-79-1
Standard:ChP
Price(USD):Negotiable
Company:Hangzhou Go Top Peptide Biotech Co.,Ltd.
Grade: Pharmaceutical Grade
Factory Location: Hangzhou, Zhejiang
Main Sales Markets: Central/South America
Monthly Production Capacity: Milligram to hundred grams
Delivery Lead Time: 2-3 weeks
Sample Provided: no
Payment Terms: L/L
Product Name:ELA-32 (human)
Synonyms:ELA 32 (human);ELA32 (human);QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP(Disulfide bridge: 17-22)
CAS No.:1680205-79-1
Catalog No.:GT-P409
Sequence:H-Gln-Arg-Pro-Val-Asn-Leu-Thr-Met-Arg-Arg-Lys-Leu-Arg-Lys-His-Asn-Cys-Leu-Gln-Arg-Arg-Cys-Met-Pro-Leu-His-Ser-Arg-Val-Pro-Phe-Pro-OH(Disulfide bridge: 17-22)
Molecular Formula:C170H289N63O39S4
Molecular Weight:3967.82
Key Specification:
Appearance: White powder
Purity(HPLC): ≥98.0%
Single Impurity(HPLC): ≤1.0%
Acetate Content(HPLC): 5.0%~12.0%
Water Content (Karl Fischer): ≤10.0%
Package: 500mg,1g, 5g, 10g, 20g, 50g, 100g, 200g, 500g
Description:
ELA-32 (human) is a receptor agonist peptide with a disulfide bond structure and contains 32 amino acids in its sequence. ELA-32 (human) has a strong affinity and high efficiency. It can activate transcription channels to promote protein self-renewal. It can also stimulate angiogenesis in cells and promote appetite.
Other services:
Hangzhou Gutuo Biotechnology Co., Ltd. Customized peptide synthesis business:
Custom peptide, peptide drug clinical peptide, order books, beauty peptide, peptide, polypeptide, detecting peptide, peptide reagents, antigenic peptides, starch, aldehyde peptide, cyclic peptide and disulfide bond bypass peptide, a peptide membranes and all kinds of antibacterial peptides, directories, peptide, phosphorylated peptide, peptide, coupling PEG BSA and KLH antigen peptide, all kinds of acid modified peptides, a variety of amine compounds modified peptides, all kinds of fluorescence labeling peptides, parity.Development and transfer of peptide and peptide technology.
MG, G, KG packaging, from R & D customization to enterprise scale production are able to provide, specific need to consult or order, if you need other peptide synthesis for the synthesis of amino acid derivatives, welcome to call, write to Gutuo Biology, we can help you with customized synthesis.
Statement:
Sales of the products of the company belongs to the raw materials, only for related qualification enterprise or unit sales, our company provide products only for scientific research, laboratory, not personal selling, more can not be eaten, product efficacy and potential application of agencies involved are from the published literature, not assessed by state food and drug administration, for reference only.No factual evidence.
Quantity is different, the region is different, the product demand is different the price will be different, please kiss must carefully ask clear.
Contact Us
Tel: (+86) 400 610 1188
WhatsApp/Telegram/Wechat: +86 13621645194
+86 15021993094